PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2687_f_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 296aa    MW: 32594.6 Da    PI: 6.5934
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2687_f_5genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.52.3e-111448136
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRt 36
                     rg WT+eEd +l  +++q+G+++W++I++    ++t
    Neem_2687_f_5 14 RGQWTPEEDNKLSSYIAQHGTRNWRLIPKNAE-TLT 48
                     89***************************998.776 PP

2Myb_DNA-binding31.54e-1055831946
                     TTTT..-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding 19 lGgg..tWktIartmgkgRtlkqcksrwqk 46
                     +G+g  +W++Ia+ ++ gRt++++k++w++
    Neem_2687_f_5 55 FGNGhcRWSLIAAQLP-GRTDNDVKNHWNT 83
                     677777**********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-12543IPR009057Homeodomain-like
PROSITE profilePS5129418.181989IPR017930Myb domain
SuperFamilySSF466894.12E-141181IPR009057Homeodomain-like
SMARTSM007172.5E-151387IPR001005SANT/Myb domain
PfamPF002491.6E-91448IPR001005SANT/Myb domain
CDDcd001672.31E-111785No hitNo description
PfamPF002494.8E-85483IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-135896IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGRIPCCERD NVKRGQWTPE EDNKLSSYIA QHGTRNWRLI PKNAETLTYK TSNLFGNGHC  60
RWSLIAAQLP GRTDNDVKNH WNTKLKKRLS GMGIDPVTHK PFSHLMAEIA TTLAPPQVAH  120
LAEAALGCFK DEMLHLLTKK RIDFQLQQSA PINTNTTYMN SKSEEKDNAI EKIKLNLSRA  180
IQEPEMLPSN KPWDPIGGIS TNFAGTCSAF PASATGFQYG SSSFGHDGAA SPWSQSICTG  240
STCTAGEQQG QLHEKVEDEN GEESEGGKGM RNGSTIFNAD CVLWDLPADD LMNPMV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006474780.10.0PREDICTED: myb-related protein 330 isoform X2
SwissprotQ7XQN12e-90MYB80_ORYSJ; Transcription factor MYB80
TrEMBLV4WH130.0V4WH13_9R
STRINGVIT_19s0015g01280.t011e-169(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM100052635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.14e-88myb domain protein 103